PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006474-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family BES1
Protein Properties Length: 317aa    MW: 34186.1 Da    PI: 9.4042
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006474-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822223.64.2e-6951512150
         DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrk.gskpleeaeaagssasaspesslqs 96 
                    +sgr ptwkErEnnkrRERrRRaiaakiy+GLRa+Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrk g+kp+ + +aag+s+++sp+ss+q 
  NNU_006474-RA   5 SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAYGNYKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKvGCKPPPSDAAAGTSTNISPCSSYQP 100
                    799******************************************************************769************************ PP

         DUF822  97 slkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvsssl 150
                    s+ ss+++spv+sy+asp+sssfpsps++d ++++    +lp+l++l++++ssl
  NNU_006474-RA 101 SPASSSFPSPVPSYHASPTSSSFPSPSRMDANPSS---YILPFLRNLAAIPSSL 151
                    ********************************985...9********9999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.1E-645131IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MTTRSSGRLP TWKERENNKR RERRRRAIAA KIYSGLRAYG NYKLPKHCDN NEVLKALCAE  60
AGWIVEEDGT TYRKVGCKPP PSDAAAGTST NISPCSSYQP SPASSSFPSP VPSYHASPTS  120
SSFPSPSRMD ANPSSYILPF LRNLAAIPSS LPPLRISNSA PVTPPLSSPT SRAPKLNPDW  180
ESLSNGSLGS FRRPFFAASA PASPTRRHHQ PPATIPECDE SDASTVDSGR WVSFQTVGPV  240
ASPSSPTFNL VKSVTEQNSS KDAVVGPGGM SWGAADRGRA AEFEFESERV KPWEGERIHE  300
IGVDDLELTL GSGKTRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254939.10.0PREDICTED: BES1/BZR1 homolog protein 2
SwissprotQ8S3071e-109BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLF6GWZ21e-143F6GWZ2_VITVI; Putative uncharacterized protein
STRINGVIT_04s0023g01250.t011e-143(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.61e-82BES1 family protein